Free Shipping on Orders Over $149 — Lab-Tested 99%+ Purity — USA Shipped

Cagrilintide 10mg - Research Peptide
Weight Management 10mg

Cagrilintide

$289.00 In Stock

Long-acting synthetic amylin analogue for obesity and metabolic research.

≥98%
HPLC Purity
COA
Included
USA
Based Supplier

Description

Long-acting synthetic amylin analogue for obesity and metabolic research.

Cagrilintide is a long-acting acylated amylin analogue engineered for extended receptor engagement at the amylin receptor complex (AMY1 and AMY3). Its mechanism involves activating calcitonin and amylin receptors in the area postrema and hypothalamus, modulating satiety signaling and gastric emptying. In the REDEFINE 1 phase 3 trial (Lau et al., published 2023), cagrilintide 2.4 mg administered weekly demonstrated statistically significant weight reduction compared to placebo over 68 weeks. Notably, Novo Nordisk's CagriSema program combines cagrilintide with semaglutide, and phase 2 data (REDEFINE 2) showed the combination achieved greater weight reduction than either agent alone, suggesting synergistic effects between amylin and GLP-1 receptor pathways. Compared to pramlintide, the only previously available amylin analogue, cagrilintide offers a substantially longer half-life (approximately 7 days vs. hours), enabling once-weekly dosing in research protocols. Research also indicates potential benefits in alcohol-related liver disease models, where amylin signaling may reduce hepatic lipid accumulation. The lyophilized powder should be stored at -20C prior to reconstitution with sterile water or bacteriostatic water; reconstituted solutions should be refrigerated at 2-8C. This compound is primarily studied by obesity research institutes, pharmaceutical laboratories investigating incretin-amylin synergy, and academic centers focused on appetite neurobiology and hepatic metabolism.

This product is supplied as a lyophilized powder and is intended for laboratory and research use only. Not for human consumption. Each vial contains 10mg of research-grade material.

Research Applications

  • Obesity and type 2 diabetes management studies
  • Synergistic weight loss research with semaglutide
  • Liver injury and alcohol-related liver disease research
  • Cardiovascular condition exploration

Specifications

Size
10mg
Purity
≥98% (HPLC)
Form
Lyophilized Powder
Molecular Formula
C194H312N54O59S2
Molecular Weight
4409.01 g/mol
CAS Number
1415456-99-3
Sequence
XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

Storage & Handling

  • Long-term storage: -20°C in a sealed, light-protected container
  • Short-term storage: 2-8°C (refrigerated) for up to 30 days
  • Reconstituted: Store at 2-8°C and use within 30 days
  • Avoid: Repeated freeze-thaw cycles, direct sunlight, and moisture exposure
  • Reconstitution: Use bacteriostatic water or sterile water for injection

Frequently Asked Questions

What is Cagrilintide and how does it work?
Cagrilintide is a long-acting synthetic analogue of amylin, a hormone co-secreted with insulin from pancreatic beta cells. It binds to amylin receptors (AMY1 and AMY3), which in preclinical models has been observed to influence satiety signaling, gastric emptying rate, and post-meal glucagon secretion. Its acylated fatty acid modification extends its half-life, enabling less frequent dosing in research protocols.
What research has been done on Cagrilintide?
Novo Nordisk's Phase 2 trials (published 2021-2023) studied cagrilintide both as a monotherapy and in combination with semaglutide (the CagriSema program). Research data showed statistically significant reductions in body weight compared to placebo. Preclinical studies have also investigated its effects on alcohol-related liver disease models and cardiovascular biomarkers in animal subjects.
How does Cagrilintide compare to Pramlintide?
Pramlintide (Symlin) is the only currently approved amylin analogue but requires multiple daily administrations due to its short half-life. Cagrilintide's acylation modification provides a substantially longer duration of action, enabling once-weekly dosing in research protocols. In comparative studies, cagrilintide demonstrated stronger receptor binding affinity at AMY1 and AMY3 receptors than native amylin or pramlintide.
What is the recommended reconstitution protocol for Cagrilintide?
For this 10mg vial, reconstitute with 2mL of bacteriostatic water to yield a concentration of 5mg/mL. Direct the water stream along the glass wall to avoid damaging the peptide structure. Allow complete dissolution before use (3-5 minutes without agitation). Store reconstituted solution at 2-8°C and use within 30 days.
What purity testing is performed on Cagrilintide?
Cagrilintide undergoes rigorous quality control including reverse-phase HPLC for purity verification (minimum 98%), electrospray ionization mass spectrometry (ESI-MS) for molecular weight confirmation, and LAL endotoxin testing. Each vial ships with a batch-specific Certificate of Analysis (COA) detailing purity percentage, peptide content, water content, and counterion analysis.

Related Products

GLP3-R (Retatrutide) 30mg
30mg In Stock

GLP3-R (Retatrutide)

Triple-agonist research peptide targeting GIP, GLP-1, and glucagon receptors for advanced metabolic studies.

$399.00
Tesamorelin 10mg
10mg In Stock

Tesamorelin

Synthetic GHRH analogue studied for visceral fat reduction and metabolic health.

$109.00
MOTS-C 40mg
40mg In Stock

MOTS-C

Mitochondrial-derived peptide for metabolic regulation and cellular energy research.

$175.00

Research Use Only. This product is not intended for human consumption, therapeutic use, or diagnostic purposes. All peptides sold by Elyte Peptides are strictly for in-vitro research and laboratory use. By purchasing, you agree to use this product in compliance with all applicable laws and regulations.